PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_010419-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 342aa    MW: 37344.4 Da    PI: 6.7524
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_010419-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.79.8e-1294138347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+  ++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
  AHYPO_010419-RA  94 PWTEDEHRMFLLGLQKLGKGDWRGIARDYVISRTPTQVASHAQKY 138
                      8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.106.8E-4321IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.32687143IPR017930Myb domain
SuperFamilySSF466896.71E-1689144IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-1990141IPR006447Myb domain, plants
SMARTSM007176.8E-1091141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-1091137IPR009057Homeodomain-like
PfamPF002494.3E-1094138IPR001005SANT/Myb domain
CDDcd001679.63E-994139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGVKLFGVRL TDGSIRKSAS MGNLSLHHNG VVGNTSPATG  60
DHTPDHVNTT TDGYASEDFV PGSSSSRDRK KGVPWTEDEH RMFLLGLQKL GKGDWRGIAR  120
DYVISRTPTQ VASHAQKYFI RLSNVSRRKR RSSLFDIVAD EGGDTPMETH DFLPEHPLDA  180
ETQDNNRPLP PAPVLDEECE SMASSNSNFN DPEPVLSKPE PDQSSSYPTD TSQNYYPIIY  240
PAYVPPFYPY PVPYWTSYNS EPIKETHEVV KPTAVLSKKP INVDELVGMS KLSLGETIGS  300
GEPSSLSLKL LDGPSRQSAF HANPAPSSSG MNSGGSPIHA V*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010677080.10.0PREDICTED: transcription factor MYB1R1
SwissprotQ2V9B03e-34MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0J8CI300.0A0A0J8CI30_BETVU; Uncharacterized protein
STRINGSolyc08g078340.2.11e-160(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-110MYB_related family protein